Lineage for d5xafe_ (5xaf E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016485Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2016486Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2016487Protein Stathmin 4 [101496] (1 species)
  7. 2016488Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries)
  8. 2016546Domain d5xafe_: 5xaf E: [343271]
    Other proteins in same PDB: d5xafa1, d5xafa2, d5xafb1, d5xafb2, d5xafc1, d5xafc2, d5xafd1, d5xafd2, d5xaff1
    automated match to d4i55e_
    complexed with 84f, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xafe_

PDB Entry: 5xaf (more details), 2.55 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z1 complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xafe_:

Sequence, based on SEQRES records: (download)

>d5xafe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5xafe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5xafe_:

Click to download the PDB-style file with coordinates for d5xafe_.
(The format of our PDB-style files is described here.)

Timeline for d5xafe_: