SCOPe 2.08: Domain d5wtda1: 5wtd A:3-332

Lineage for d5wtda1 (5wtd A:3-332)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d5wtda1: 5wtd A:3-332 [343263]
   automated match to d1jw1a1
   complexed with fe, mli, ru

Details for d5wtda1

PDB Entry: 5wtd, 2.5 Å

PDB Description: structure of human serum transferrin bound ruthenium at n-lobe

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d5wtda1:

Sequence; same for both SEQRES and ATOM records:

>d5wtda1 c.94.1.0 (A:3-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
lkvpprmdakmylgyeyvtairnlregtcp

Timeline for d5wtda1:

• d5wtda1 first appeared in SCOPe 2.06
  
• d5wtda1 appears in SCOPe 2.07