Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (13 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries) Uniprot P02593 |
Domain d5wbxr1: 5wbx R:4-147 [343259] Other proteins in same PDB: d5wbxr2 automated match to d3g43b_ complexed with ajy, ca, gol, so4 |
PDB Entry: 5wbx (more details), 1.9 Å
SCOPe Domain Sequences for d5wbxr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wbxr1 a.39.1.5 (R:4-147) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti dfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevde mireadidgdgqvnyeefvqmmta
Timeline for d5wbxr1: