Lineage for d5w6ga1 (5w6g A:5-326)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776381Species Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId:464623] [343253] (2 PDB entries)
  8. 2776383Domain d5w6ga1: 5w6g A:5-326 [343254]
    Other proteins in same PDB: d5w6ga2, d5w6gb_, d5w6gh1, d5w6gh2, d5w6gl1, d5w6gl2
    automated match to d4d00c_
    complexed with gol, nag, so4

Details for d5w6ga1

PDB Entry: 5w6g (more details), 2.79 Å

PDB Description: human antibody 6649 in complex with influenza hemagglutinin h1 solomon islands
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d5w6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w6ga1 b.19.1.0 (A:5-326) automated matches {Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId: 464623]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnips

SCOPe Domain Coordinates for d5w6ga1:

Click to download the PDB-style file with coordinates for d5w6ga1.
(The format of our PDB-style files is described here.)

Timeline for d5w6ga1: