SCOPe 2.08: Domain d5w6ga1: 5w6g A:5-326

Lineage for d5w6ga1 (5w6g A:5-326)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId:464623] [343253] (2 PDB entries)

8. Domain d5w6ga1: 5w6g A:5-326 [343254]
   Other proteins in same PDB: d5w6ga2, d5w6gb_, d5w6gh1, d5w6gh2, d5w6gl1, d5w6gl2
   automated match to d4d00c_
   complexed with gol, nag, so4

Details for d5w6ga1

PDB Entry: 5w6g, 2.79 Å

PDB Description: human antibody 6649 in complex with influenza hemagglutinin h1 solomon islands

PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d5w6ga1:

Sequence; same for both SEQRES and ATOM records:

>d5w6ga1 b.19.1.0 (A:5-326) automated matches {Influenza A virus (a/solomon islands/3/2006(h1n1)) [TaxId: 464623]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnips

Timeline for d5w6ga1:

• d5w6ga1 first appeared in SCOPe 2.06
  
• d5w6ga1 appears in SCOPe 2.07