SCOPe 2.06: Domain d5ujtg2: 5ujt G:82-178

Lineage for d5ujtg2 (5ujt G:82-178)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5ujtg2: 5ujt G:82-178 [343243]
   Other proteins in same PDB: d5ujta1, d5ujtb1, d5ujtd1, d5ujte1, d5ujtg1, d5ujth1
   automated match to d4z7va2
   complexed with nag

Details for d5ujtg2

PDB Entry: 5ujt, 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3

PDB Compounds: (G:) MHC class II antigen

SCOPe Domain Sequences for d5ujtg2:

Sequence; same for both SEQRES and ATOM records:

>d5ujtg2 b.1.1.2 (G:82-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsddeiydckvehwgldepllkhw

Timeline for d5ujtg2:

• d5ujtg2 is new in SCOPe 2.06-stable
  
• d5ujtg2 appears in SCOPe 2.07
  
• d5ujtg2 appears in the current release, SCOPe 2.08