SCOPe 2.08: Domain d5ujtg1: 5ujt G:-2-81

Lineage for d5ujtg1 (5ujt G:-2-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5ujtg1: 5ujt G:-2-81 [343242]
   Other proteins in same PDB: d5ujta2, d5ujtb1, d5ujtb2, d5ujtd2, d5ujte1, d5ujte2, d5ujtg2, d5ujth1, d5ujth2
   automated match to d4z7ua1
   complexed with nag

Details for d5ujtg1

PDB Entry: 5ujt, 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3

PDB Compounds: (G:) MHC class II antigen

SCOPe Domain Sequences for d5ujtg1:

Sequence; same for both SEQRES and ATOM records:

>d5ujtg1 d.19.1.0 (G:-2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdp
qfaltniavlkhnlncvikrsnsta

Timeline for d5ujtg1:

• d5ujtg1 first appeared in SCOPe 2.06
  
• d5ujtg1 appears in SCOPe 2.07