Lineage for d5ujte1 (5ujt E:3-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938568Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)
  8. 2938582Domain d5ujte1: 5ujt E:3-94 [343240]
    Other proteins in same PDB: d5ujta1, d5ujta2, d5ujtb2, d5ujtd1, d5ujtd2, d5ujte2, d5ujtg1, d5ujtg2, d5ujth2
    automated match to d1jk8b2
    complexed with nag

Details for d5ujte1

PDB Entry: 5ujt (more details), 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3
PDB Compounds: (E:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ujte1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujte1 d.19.1.1 (E:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlqrr

SCOPe Domain Coordinates for d5ujte1:

Click to download the PDB-style file with coordinates for d5ujte1.
(The format of our PDB-style files is described here.)

Timeline for d5ujte1: