SCOPe 2.08: Domain d5ujte1: 5ujt E:3-94

Lineage for d5ujte1 (5ujt E:3-94)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d5ujte1: 5ujt E:3-94 [343240]
   Other proteins in same PDB: d5ujta1, d5ujta2, d5ujtb2, d5ujtd1, d5ujtd2, d5ujte2, d5ujtg1, d5ujtg2, d5ujth2
   automated match to d1jk8b2
   complexed with nag

Details for d5ujte1

PDB Entry: 5ujt, 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3

PDB Compounds: (E:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ujte1:

Sequence; same for both SEQRES and ATOM records:

>d5ujte1 d.19.1.1 (E:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlqrr

Timeline for d5ujte1:

• d5ujte1 first appeared in SCOPe 2.06
  
• d5ujte1 appears in SCOPe 2.07