SCOPe 2.06: Domain d5w6gl1: 5w6g L:2-113

Lineage for d5w6gl1 (5w6g L:2-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5w6gl1: 5w6g L:2-113 [343238]
   Other proteins in same PDB: d5w6ga1, d5w6ga2, d5w6gb_, d5w6gl2
   automated match to d1aqkl1
   complexed with gol, nag, so4

Details for d5w6gl1

PDB Entry: 5w6g, 2.79 Å

PDB Description: human antibody 6649 in complex with influenza hemagglutinin h1 solomon islands

PDB Compounds: (L:) 6649 antibody light chain

SCOPe Domain Sequences for d5w6gl1:

Sequence; same for both SEQRES and ATOM records:

>d5w6gl1 b.1.1.0 (L:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvsisctgthsnigagfdvhwyqqlpgtapklliyannnrpsgvp
drfsgsksgssaslaitglqaedeadyycqsfdsilsgdlvfgggtkltvlg

Timeline for d5w6gl1:

• d5w6gl1 is new in SCOPe 2.06-stable
  
• d5w6gl1 appears in SCOPe 2.07
  
• d5w6gl1 appears in the current release, SCOPe 2.08