Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) automatically mapped to Pfam PF08771 |
Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
Protein automated matches [193175] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193176] (6 PDB entries) |
Domain d5wbhc_: 5wbh C: [343233] Other proteins in same PDB: d5wbhe2 automated match to d2gaqa_ |
PDB Entry: 5wbh (more details), 1.75 Å
SCOPe Domain Sequences for d5wbhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wbhc_ a.24.7.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd lmeaqewcrkymksgnvkdltqawdlyyhvfrrisk
Timeline for d5wbhc_: