Lineage for d1arha_ (1arh A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73102Family c.67.1.1: AAT-like [53384] (5 proteins)
  6. 73143Protein Aspartate aminotransferase, AAT [53385] (6 species)
  7. 73177Species Escherichia coli [TaxId:562] [53390] (49 PDB entries)
  8. 73216Domain d1arha_: 1arh A: [34321]

Details for d1arha_

PDB Entry: 1arh (more details), 2.3 Å

PDB Description: aspartate aminotransferase, y225r/r386a mutant

SCOP Domain Sequences for d1arha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arha_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfarqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgavnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1arha_:

Click to download the PDB-style file with coordinates for d1arha_.
(The format of our PDB-style files is described here.)

Timeline for d1arha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1arhb_