Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries) |
Domain d5ub9b_: 5ub9 B: [343196] automated match to d2vd2a_ complexed with act, cl, zn |
PDB Entry: 5ub9 (more details), 1.9 Å
SCOPe Domain Sequences for d5ub9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ub9b_ c.94.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 195099]} trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke vkviyesracliqkenalskekqalvdkimlrvag
Timeline for d5ub9b_: