Class b: All beta proteins [48724] (178 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.1: Mss4-like [51316] (5 families) duplication: tandem repeat of two similar structural motifs |
Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins) contains an insertion of alpha helical hairpin; lacks zinc-binding site automatically mapped to Pfam PF00838 |
Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [117337] (6 PDB entries) Uniprot P13693 |
Domain d5o9la1: 5o9l A:1-172 [343191] Other proteins in same PDB: d5o9la2, d5o9lb2 automated match to d1h6qa_ |
PDB Entry: 5o9l (more details), 1.75 Å
SCOPe Domain Sequences for d5o9la1:
Sequence, based on SEQRES records: (download)
>d5o9la1 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]} miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc
>d5o9la1 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]} miiyrdlishdemfsdiykireiadglclevegkmvsrtegtestvitgvdivmnhhlqe tsftkeaykkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenm npdgmvalldyredgvtpymiffkdglemekc
Timeline for d5o9la1: