Lineage for d5ubgb_ (5ubg B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163579Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)
  8. 2163581Domain d5ubgb_: 5ubg B: [343184]
    automated match to d2vd2a_
    complexed with cl, prt, zn

Details for d5ubgb_

PDB Entry: 5ubg (more details), 1.9 Å

PDB Description: catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp
PDB Compounds: (B:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5ubgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ubgb_ c.94.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 195099]}
ntrlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglif
dgvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfe
glriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlk
evkviyesracliqkenalskekqalvdkimlrvagvmqare

SCOPe Domain Coordinates for d5ubgb_:

Click to download the PDB-style file with coordinates for d5ubgb_.
(The format of our PDB-style files is described here.)

Timeline for d5ubgb_: