Lineage for d5ouga_ (5oug A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084696Protein automated matches [190922] (2 species)
    not a true protein
  7. 2084977Species Human (Homo sapiens) [TaxId:9606] [189722] (6 PDB entries)
  8. 2084988Domain d5ouga_: 5oug A: [343179]
    automated match to d5afna_
    complexed with 9z0, bma, dms, l0b, man, nag

Details for d5ouga_

PDB Entry: 5oug (more details), 2.57 Å

PDB Description: humanized alpha-achbp (acetylcholine binding protein) in complex with lobeline and allosteric binder fragment 4.
PDB Compounds: (A:) Humanized alpha-AChBP

SCOPe Domain Sequences for d5ouga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ouga_ b.96.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5ouga_:

Click to download the PDB-style file with coordinates for d5ouga_.
(The format of our PDB-style files is described here.)

Timeline for d5ouga_: