Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [260526] (10 PDB entries) |
Domain d5otaa_: 5ota A: [343178] automated match to d4p0ib_ protein/DNA complex; complexed with aqq, edo |
PDB Entry: 5ota (more details), 2.1 Å
SCOPe Domain Sequences for d5otaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5otaa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag rydaimaamgiqparekviafsrpylltpmtflttadspllktqvaienlpldnitpeqk aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv qklsqqwfgydasp
Timeline for d5otaa_: