Lineage for d5otaa_ (5ota A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915217Species Agrobacterium tumefaciens [TaxId:176299] [260526] (10 PDB entries)
  8. 2915227Domain d5otaa_: 5ota A: [343178]
    automated match to d4p0ib_
    protein/DNA complex; complexed with aqq, edo

Details for d5otaa_

PDB Entry: 5ota (more details), 2.1 Å

PDB Description: structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid
PDB Compounds: (A:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d5otaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5otaa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
rydaimaamgiqparekviafsrpylltpmtflttadspllktqvaienlpldnitpeqk
aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
qklsqqwfgydasp

SCOPe Domain Coordinates for d5otaa_:

Click to download the PDB-style file with coordinates for d5otaa_.
(The format of our PDB-style files is described here.)

Timeline for d5otaa_: