Lineage for d5n88h_ (5n88 H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (193 PDB entries)
  8. 2347310Domain d5n88h_: 5n88 H: [343175]
    Other proteins in same PDB: d5n88d_, d5n88e1, d5n88e2
    automated match to d2vyrh_

Details for d5n88h_

PDB Entry: 5n88 (more details), 1.7 Å

PDB Description: crystal structure of antibody bound to viral protein
PDB Compounds: (H:) VH59 antibody

SCOPe Domain Sequences for d5n88h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n88h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfstfsmnwvrqapgkglewvsyisrtsktiyy
adsvkgrftisrdnskntlylqmnslraedtavyycarggwalgdeipssflefdywgqg
tlvtvs

SCOPe Domain Coordinates for d5n88h_:

Click to download the PDB-style file with coordinates for d5n88h_.
(The format of our PDB-style files is described here.)

Timeline for d5n88h_: