SCOPe 2.07: Domain d5orga_: 5org A:

Lineage for d5orga_ (5org A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:1183423] [343144] (1 PDB entry)

8. Domain d5orga_: 5org A: [343173]
   automated match to d4pp0b_
   protein/DNA complex; complexed with 6db, act, cl, edo, gol, na

Details for d5orga_

PDB Entry: 5org, 1.99 Å

PDB Description: structure of the periplasmic binding protein (pbp) occj from a. tumefaciens b6 in complex with octopine.

PDB Compounds: (A:) Octopine-binding periplasmic protein

SCOPe Domain Sequences for d5orga_:

Sequence; same for both SEQRES and ATOM records:

>d5orga_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 1183423]}
mqeksitiateggyapwnfsgpggkldgfeidlanalcekmkakcqivaqnwdgimpslt
gkkydaimaamsvtpkrqevigfsipyaagingfavmgdsklaempglgetysldsqada
akkaiadissflngttvgvqgsttastfldkyfkgsvdikeyksveehnldltsgrldav
lanatvlaaaiekpemkgaklvgplfsggefgvvavglrkedtalkadfdaaikaasedg
tiktlslkwfkvdvtpq

Timeline for d5orga_:

• d5orga_ first appeared in SCOPe 2.06
  
• d5orga_ appears in the current release, SCOPe 2.08