Lineage for d5orea1 (5ore A:21-276)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523445Species Rhizobium radiobacter [TaxId:358] [343165] (5 PDB entries)
  8. 2523453Domain d5orea1: 5ore A:21-276 [343166]
    Other proteins in same PDB: d5orea2
    automated match to d4pp0b_
    complexed with cl, edo

Details for d5orea1

PDB Entry: 5ore (more details), 2.35 Å

PDB Description: structure of the periplasmic binding protein (pbp) occj from agrobacterium tumefaciens b6
PDB Compounds: (A:) Octopine-binding periplasmic protein

SCOPe Domain Sequences for d5orea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5orea1 c.94.1.0 (A:21-276) automated matches {Rhizobium radiobacter [TaxId: 358]}
qeksitiateggyapwnfsgpggkldgfeidlanalcekmkakcqivaqnwdgimpsltg
kkydaimaamsvtpkrqevigfsipyaagingfavmgdsklaempglgetysldsqadaa
kkaiadissflngttvgvqgsttastfldkyfkgsvdikeyksveehnldltsgrldavl
anatvlaaaiekpemkgaklvgplfsggefgvvavglrkedtalkadfdaaikaasedgt
iktlslkwfkvdvtpq

SCOPe Domain Coordinates for d5orea1:

Click to download the PDB-style file with coordinates for d5orea1.
(The format of our PDB-style files is described here.)

Timeline for d5orea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5orea2