Lineage for d5ot8b_ (5ot8 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163469Species Agrobacterium tumefaciens [TaxId:176299] [260526] (9 PDB entries)
  8. 2163483Domain d5ot8b_: 5ot8 B: [343164]
    automated match to d4p0ib_
    protein/DNA complex; complexed with 6db, cl, edo, peg, so4; mutant

Details for d5ot8b_

PDB Entry: 5ot8 (more details), 2.35 Å

PDB Description: structure of the periplasmic binding protein (pbp) noct-g97s mutant from a. tumefaciens c58 in complex with octopine.
PDB Compounds: (B:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d5ot8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ot8b_ c.94.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
rydaimaamsiqparekviafsrpylltpmtflttadspllktqvaienlpldnitpeqk
aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
qklsqqwfgydaspk

SCOPe Domain Coordinates for d5ot8b_:

Click to download the PDB-style file with coordinates for d5ot8b_.
(The format of our PDB-style files is described here.)

Timeline for d5ot8b_: