Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:1183423] [343144] (1 PDB entry) |
Domain d5orgb_: 5org B: [343145] automated match to d4pp0b_ protein/DNA complex; complexed with 6db, act, cl, edo, gol, na |
PDB Entry: 5org (more details), 1.99 Å
SCOPe Domain Sequences for d5orgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5orgb_ c.94.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 1183423]} ksitiateggyapwnfsgpggkldgfeidlanalcekmkakcqivaqnwdgimpsltgkk ydaimaamsvtpkrqevigfsipyaagingfavmgdsklaempglgetysldsqadaakk aiadissflngttvgvqgsttastfldkyfkgsvdikeyksveehnldltsgrldavlan atvlaaaiekpemkgaklvgplfsggefgvvavglrkedtalkadfdaaikaasedgtik tlslkwfkvdvtp
Timeline for d5orgb_: