SCOPe 2.06: Domain d5mmea1: 5mme A:1081-1197

Lineage for d5mmea1 (5mme A:1081-1197)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)

8. Domain d5mmea1: 5mme A:1081-1197 [343126]
   Other proteins in same PDB: d5mmea2, d5mmeb2
   automated match to d4nyva_
   complexed with 8q6

Details for d5mmea1

PDB Entry: 5mme, 1.35 Å

PDB Description: crystal structure of crebbp bromodomain complexd with us46c

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5mmea1:

Sequence; same for both SEQRES and ATOM records:

>d5mmea1 a.29.2.1 (A:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d5mmea1:

• d5mmea1 is new in SCOPe 2.06-stable
  
• d5mmea1 appears in SCOPe 2.07
  
• d5mmea1 appears in the current release, SCOPe 2.08