SCOPe 2.07: Domain d5mi3a3: 5mi3 A:298-394

Lineage for d5mi3a3 (5mi3 A:298-394)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:331112] [343073] (2 PDB entries)

8. Domain d5mi3a3: 5mi3 A:298-394 [343119]
   Other proteins in same PDB: d5mi3a1, d5mi3a2, d5mi3b1, d5mi3b2
   automated match to d1d8ta2
   complexed with gdp, mg

Details for d5mi3a3

PDB Entry: 5mi3, 2.8 Å

PDB Description: structure of phosphorylated translation elongation factor ef-tu from e. coli

PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d5mi3a3:

Sequence; same for both SEQRES and ATOM records:

>d5mi3a3 b.44.1.0 (A:298-394) automated matches {Escherichia coli [TaxId: 331112]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

Timeline for d5mi3a3:

• d5mi3a3 first appeared in SCOPe 2.06
  
• d5mi3a3 appears in the current release, SCOPe 2.08