Lineage for d5mknh_ (5mkn H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057725Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2057726Protein automated matches [190914] (13 species)
    not a true protein
  7. 2057865Species Methanococcus vannielii [TaxId:2187] [343057] (1 PDB entry)
  8. 2057873Domain d5mknh_: 5mkn H: [343108]
    automated match to d1mgqa_
    complexed with pg4, u5p

Details for d5mknh_

PDB Entry: 5mkn (more details), 2.55 Å

PDB Description: crystal structure of smap (lsm) protein from methanococcus vannielii
PDB Compounds: (H:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d5mknh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mknh_ b.38.1.0 (H:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
vrgdnvlyvsl

SCOPe Domain Coordinates for d5mknh_:

Click to download the PDB-style file with coordinates for d5mknh_.
(The format of our PDB-style files is described here.)

Timeline for d5mknh_: