Lineage for d5m9xb1 (5m9x B:1-434)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093517Protein automated matches [190099] (25 species)
    not a true protein
  7. 2093544Species Bifidobacterium adolescentis [TaxId:1680] [255183] (4 PDB entries)
  8. 2093549Domain d5m9xb1: 5m9x B:1-434 [343100]
    Other proteins in same PDB: d5m9xb2
    automated match to d1r7aa2
    complexed with 7kp

Details for d5m9xb1

PDB Entry: 5m9x (more details), 2.35 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d5m9xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m9xb1 c.1.8.1 (B:1-434) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirlnavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

SCOPe Domain Coordinates for d5m9xb1:

Click to download the PDB-style file with coordinates for d5m9xb1.
(The format of our PDB-style files is described here.)

Timeline for d5m9xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m9xb2