Lineage for d5mjda_ (5mjd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301798Protein Neuroglobin [100978] (2 species)
  7. 2301806Species Mouse (Mus musculus) [TaxId:10090] [109625] (36 PDB entries)
    Uniprot Q9ER97
  8. 2301820Domain d5mjda_: 5mjd A: [343051]
    automated match to d1q1fa_
    complexed with hem, oxy, so4

Details for d5mjda_

PDB Entry: 5mjd (more details), 1.7 Å

PDB Description: metngb under oxygen at 80 bar
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d5mjda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mjda_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

SCOPe Domain Coordinates for d5mjda_:

Click to download the PDB-style file with coordinates for d5mjda_.
(The format of our PDB-style files is described here.)

Timeline for d5mjda_: