SCOPe 2.07: Domain d5m00g2: 5m00 G:120-196

Lineage for d5m00g2 (5m00 G:120-196)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d5m00g2: 5m00 G:120-196 [343046]
   Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b1, d5m00b2, d5m00g1, d5m00h1
   automated match to d1tcra2

Details for d5m00g2

PDB Entry: 5m00, 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv

PDB Compounds: (G:) Protein Trav14-1,Uncharacterized protein

SCOPe Domain Sequences for d5m00g2:

Sequence, based on SEQRES records:

>d5m00g2 b.1.1.2 (G:120-196) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng
aiawsnqtsftcqdifk

Sequence, based on observed residues (ATOM records):

>d5m00g2 b.1.1.2 (G:120-196) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkadsksnga
iawsnqtsftcqdifk

Timeline for d5m00g2:

• d5m00g2 first appeared in SCOPe 2.06
  
• d5m00g2 appears in the current release, SCOPe 2.08