![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d5m00g2: 5m00 G:120-196 [343046] Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b1, d5m00b2, d5m00g1, d5m00h1 automated match to d1tcra2 |
PDB Entry: 5m00 (more details), 1.95 Å
SCOPe Domain Sequences for d5m00g2:
Sequence, based on SEQRES records: (download)
>d5m00g2 b.1.1.2 (G:120-196) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng aiawsnqtsftcqdifk
>d5m00g2 b.1.1.2 (G:120-196) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkadsksnga iawsnqtsftcqdifk
Timeline for d5m00g2: