Lineage for d5m00g2 (5m00 G:120-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752639Domain d5m00g2: 5m00 G:120-196 [343046]
    Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b1, d5m00b2, d5m00g1, d5m00h1
    automated match to d1tcra2

Details for d5m00g2

PDB Entry: 5m00 (more details), 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv
PDB Compounds: (G:) Protein Trav14-1,Uncharacterized protein

SCOPe Domain Sequences for d5m00g2:

Sequence, based on SEQRES records: (download)

>d5m00g2 b.1.1.2 (G:120-196) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng
aiawsnqtsftcqdifk

Sequence, based on observed residues (ATOM records): (download)

>d5m00g2 b.1.1.2 (G:120-196) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkadsksnga
iawsnqtsftcqdifk

SCOPe Domain Coordinates for d5m00g2:

Click to download the PDB-style file with coordinates for d5m00g2.
(The format of our PDB-style files is described here.)

Timeline for d5m00g2: