Lineage for d5m00g1 (5m00 G:9-119)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) 
Domain d5m00g1: 5m00 G:9-119 [343045]
Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b1, d5m00b2, d5m00g2, d5m00h2
automated match to d1tcra1
Details for d5m00g1
PDB Entry: 5m00 (more details), 1.95 Å
PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv
PDB Compounds: (G:) Protein Trav14-1,Uncharacterized proteinSCOPe Domain Sequences for d5m00g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m00g1 b.1.1.0 (G:9-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qqvrqspqsltvweggttvltcsyedstfnyfpwyqqfpgegpallisilsvsdkkedgr
fttffnkrekklslhiidsqpgdsatyfcaalygnekitfgagtkltikpn
SCOPe Domain Coordinates for d5m00g1:
Click to download the PDB-style file with coordinates for d5m00g1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5m00g1:
View in 3D
