Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries) Uniprot P01887 |
Domain d5m00b1: 5m00 B:1-99 [343037] Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b2, d5m00g1, d5m00g2, d5m00h1, d5m00h2 automated match to d2xfxb_ |
PDB Entry: 5m00 (more details), 1.95 Å
SCOPe Domain Sequences for d5m00b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m00b1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d5m00b1: