Lineage for d5m00b1 (5m00 B:1-99)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025828Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
    Uniprot P01887
  8. 2025955Domain d5m00b1: 5m00 B:1-99 [343037]
    Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b2, d5m00g1, d5m00g2, d5m00h1, d5m00h2
    automated match to d2xfxb_

Details for d5m00b1

PDB Entry: 5m00 (more details), 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d5m00b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m00b1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d5m00b1:

Click to download the PDB-style file with coordinates for d5m00b1.
(The format of our PDB-style files is described here.)

Timeline for d5m00b1: