![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) ![]() can form closed, open and helix-swapped bundles |
![]() | Family a.24.19.0: automated matches [191633] (1 protein) not a true family |
![]() | Protein automated matches [191166] (3 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [343027] (2 PDB entries) |
![]() | Domain d5mawe_: 5maw E: [343028] automated match to d3iqca_ |
PDB Entry: 5maw (more details), 1.5 Å
SCOPe Domain Sequences for d5mawe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mawe_ a.24.19.0 (E:) automated matches {Bacillus subtilis [TaxId: 1423]} yqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftln rnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqs
Timeline for d5mawe_: