Lineage for d5mawe_ (5maw E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700609Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) (S)
    can form closed, open and helix-swapped bundles
  5. 2700621Family a.24.19.0: automated matches [191633] (1 protein)
    not a true family
  6. 2700622Protein automated matches [191166] (3 species)
    not a true protein
  7. 2700623Species Bacillus subtilis [TaxId:1423] [343027] (2 PDB entries)
  8. 2700624Domain d5mawe_: 5maw E: [343028]
    automated match to d3iqca_

Details for d5mawe_

PDB Entry: 5maw (more details), 1.5 Å

PDB Description: crystal structure of the flagellin-flis complex from bacillus subtilis
PDB Compounds: (E:) flagellar protein FliS

SCOPe Domain Sequences for d5mawe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mawe_ a.24.19.0 (E:) automated matches {Bacillus subtilis [TaxId: 1423]}
yqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftln
rnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqs

SCOPe Domain Coordinates for d5mawe_:

Click to download the PDB-style file with coordinates for d5mawe_.
(The format of our PDB-style files is described here.)

Timeline for d5mawe_: