SCOPe 2.07: Domain d5manb2: 5man B:435-504

Lineage for d5manb2 (5man B:435-504)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bifidobacterium adolescentis [TaxId:1680] [255184] (4 PDB entries)

8. Domain d5manb2: 5man B:435-504 [343023]
   Other proteins in same PDB: d5manb1
   automated match to d1r7aa1
   complexed with ngr

Details for d5manb2

PDB Entry: 5man, 2.04 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose

PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d5manb2:

Sequence; same for both SEQRES and ATOM records:

>d5manb2 b.71.1.0 (B:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

Timeline for d5manb2:

• d5manb2 first appeared in SCOPe 2.06
  
• d5manb2 appears in the current release, SCOPe 2.08