SCOPe 2.07: Domain d5manb1: 5man B:1-434

Lineage for d5manb1 (5man B:1-434)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Bifidobacterium adolescentis [TaxId:1680] [255183] (4 PDB entries)

8. Domain d5manb1: 5man B:1-434 [343022]
   Other proteins in same PDB: d5manb2
   automated match to d1r7aa2
   complexed with ngr

Details for d5manb1

PDB Entry: 5man, 2.04 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose

PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d5manb1:

Sequence; same for both SEQRES and ATOM records:

>d5manb1 c.1.8.1 (B:1-434) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirlnavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

Timeline for d5manb1:

• d5manb1 first appeared in SCOPe 2.06
  
• d5manb1 appears in the current release, SCOPe 2.08