Lineage for d5manb1 (5man B:1-434)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830377Species Bifidobacterium adolescentis [TaxId:1680] [255183] (4 PDB entries)
  8. 2830381Domain d5manb1: 5man B:1-434 [343022]
    Other proteins in same PDB: d5manb2
    automated match to d1r7aa2

Details for d5manb1

PDB Entry: 5man (more details), 2.04 Å

PDB Description: structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d5manb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5manb1 c.1.8.1 (B:1-434) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirlnavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

SCOPe Domain Coordinates for d5manb1:

Click to download the PDB-style file with coordinates for d5manb1.
(The format of our PDB-style files is described here.)

Timeline for d5manb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5manb2