SCOPe 2.06: Domain d5m00a2: 5m00 A:182-276

Lineage for d5m00a2 (5m00 A:182-276)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d5m00a2: 5m00 A:182-276 [343021]
   Other proteins in same PDB: d5m00a1, d5m00b1, d5m00b2, d5m00g1, d5m00g2, d5m00h1, d5m00h2
   automated match to d1qlfa1

Details for d5m00a2

PDB Entry: 5m00, 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5m00a2:

Sequence; same for both SEQRES and ATOM records:

>d5m00a2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d5m00a2:

• d5m00a2 is new in SCOPe 2.06-stable
  
• d5m00a2 appears in SCOPe 2.07
  
• d5m00a2 appears in the current release, SCOPe 2.08