Lineage for d5m00a1 (5m00 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545067Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)
  8. 2545091Domain d5m00a1: 5m00 A:1-181 [343020]
    Other proteins in same PDB: d5m00a2, d5m00b1, d5m00b2, d5m00g1, d5m00g2, d5m00h1, d5m00h2
    automated match to d1qlfa2

Details for d5m00a1

PDB Entry: 5m00 (more details), 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5m00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m00a1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d5m00a1:

Click to download the PDB-style file with coordinates for d5m00a1.
(The format of our PDB-style files is described here.)

Timeline for d5m00a1: