SCOPe 2.06: Domain d5m00a1: 5m00 A:1-181

Lineage for d5m00a1 (5m00 A:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (27 PDB entries)

8. Domain d5m00a1: 5m00 A:1-181 [343020]
   Other proteins in same PDB: d5m00a2, d5m00b1, d5m00b2, d5m00g1, d5m00g2, d5m00h1, d5m00h2
   automated match to d1qlfa2

Details for d5m00a1

PDB Entry: 5m00, 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5m00a1:

Sequence; same for both SEQRES and ATOM records:

>d5m00a1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d5m00a1:

• d5m00a1 is new in SCOPe 2.06-stable
  
• d5m00a1 appears in SCOPe 2.07
  
• d5m00a1 appears in the current release, SCOPe 2.08