![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (6 species) not a true protein |
![]() | Species Shigella flexneri [TaxId:623] [343012] (1 PDB entry) |
![]() | Domain d5lp9a_: 5lp9 A: [343013] automated match to d2uy7b1 |
PDB Entry: 5lp9 (more details), 0.89 Å
SCOPe Domain Sequences for d5lp9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lp9a_ b.2.3.0 (A:) automated matches {Shigella flexneri [TaxId: 623]} adtttvnggtihfkgevvnaacavdagsvdqtvqlgqvrtaslkqagatssavgfniqln dcdttvatkaavaflgtaidatrtdvlalqssaagsatnvgvqildrtgnaltldgatfs aqttlnngtntipfqaryyaigeatpgaanadatfkvqyq
Timeline for d5lp9a_: