Lineage for d5lp9a_ (5lp9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040890Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2040891Protein automated matches [190503] (6 species)
    not a true protein
  7. 2040917Species Shigella flexneri [TaxId:623] [343012] (1 PDB entry)
  8. 2040918Domain d5lp9a_: 5lp9 A: [343013]
    automated match to d2uy7b1

Details for d5lp9a_

PDB Entry: 5lp9 (more details), 0.89 Å

PDB Description: fima wt from s. flexneri
PDB Compounds: (A:) Major type 1 subunit fimbrin (Pilin)

SCOPe Domain Sequences for d5lp9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lp9a_ b.2.3.0 (A:) automated matches {Shigella flexneri [TaxId: 623]}
adtttvnggtihfkgevvnaacavdagsvdqtvqlgqvrtaslkqagatssavgfniqln
dcdttvatkaavaflgtaidatrtdvlalqssaagsatnvgvqildrtgnaltldgatfs
aqttlnngtntipfqaryyaigeatpgaanadatfkvqyq

SCOPe Domain Coordinates for d5lp9a_:

Click to download the PDB-style file with coordinates for d5lp9a_.
(The format of our PDB-style files is described here.)

Timeline for d5lp9a_: