SCOPe 2.08: Domain d6blra2: 6blr A:85-182

Lineage for d6blra2 (6blr A:85-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6blra2: 6blr A:85-182 [343007]
   Other proteins in same PDB: d6blra1
   automated match to d1f3ja1
   complexed with edo

Details for d6blra2

PDB Entry: 6blr, 1.96 Å

PDB Description: crystal structure of iag7 in complex with insulin mimotope p8e9e6ss

PDB Compounds: (A:) IAg7 alpha chain

SCOPe Domain Sequences for d6blra2:

Sequence; same for both SEQRES and ATOM records:

>d6blra2 b.1.1.2 (A:85-182) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwep

Timeline for d6blra2:

• d6blra2 first appeared in SCOPe 2.06
  
• d6blra2 appears in SCOPe 2.07