SCOPe 2.08: Domain d6bn6b1: 6bn6 B:265-486

Lineage for d6bn6b1 (6bn6 B:265-486)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d6bn6b1: 6bn6 B:265-486 [342975]
   Other proteins in same PDB: d6bn6b2
   automated match to d3l0la_
   complexed with so4, xgh

Details for d6bn6b1

PDB Entry: 6bn6, 2.4 Å

PDB Description: identification of bicyclic hexafluoroisopropyl alcohol sulfonamides as rorgt/rorc inverse agonists

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6bn6b1:

Sequence; same for both SEQRES and ATOM records:

>d6bn6b1 a.123.1.0 (B:265-486) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqif

Timeline for d6bn6b1:

• d6bn6b1 first appeared in SCOPe 2.06
  
• d6bn6b1 appears in SCOPe 2.07