Lineage for d1yoo__ (1yoo -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399758Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 399759Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 399760Family c.67.1.1: AAT-like [53384] (7 proteins)
  6. 399805Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 399839Species Escherichia coli [TaxId:562] [53390] (52 PDB entries)
  8. 399855Domain d1yoo__: 1yoo - [34295]
    complexed with iva, plp; mutant

Details for d1yoo__

PDB Entry: 1yoo (more details), 2.4 Å

PDB Description: aspartate aminotransferase mutant atb17 with isovaleric acid

SCOP Domain Sequences for d1yoo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yoo__ c.67.1.1 (-) Aspartate aminotransferase, AAT {Escherichia coli}
mfenittapadpilgladllraderpgkidlgmgvyndetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
rrvwvsnpgwpthksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgtctlvaadsetvdrafsqmkaairvnyssppahgasvvatilgn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsftikqngmfffggltkeqvlr
lreefgvyavasgrlnvagmtpdnlaplceaivavl

SCOP Domain Coordinates for d1yoo__:

Click to download the PDB-style file with coordinates for d1yoo__.
(The format of our PDB-style files is described here.)

Timeline for d1yoo__: