Lineage for d1yoo__ (1yoo -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26198Family c.67.1.1: AAT-like [53384] (3 proteins)
  6. 26232Protein Aspartate aminotransferase, AAT [53385] (6 species)
  7. 26266Species Escherichia coli [TaxId:562] [53390] (49 PDB entries)
  8. 26282Domain d1yoo__: 1yoo - [34295]

Details for d1yoo__

PDB Entry: 1yoo (more details), 2.4 Å

PDB Description: aspartate aminotransferase mutant atb17 with isovaleric acid

SCOP Domain Sequences for d1yoo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yoo__ c.67.1.1 (-) Aspartate aminotransferase, AAT {Escherichia coli}
mfenittapadpilgladllraderpgkidlgmgvyndetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
rrvwvsnpgwpthksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgtctlvaadsetvdrafsqmkaairvnyssppahgasvvatilgn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsftikqngmfffggltkeqvlr
lreefgvyavasgrlnvagmtpdnlaplceaivavl

SCOP Domain Coordinates for d1yoo__:

Click to download the PDB-style file with coordinates for d1yoo__.
(The format of our PDB-style files is described here.)

Timeline for d1yoo__: