SCOPe 2.08: Domain d5vubb_: 5vub B:

Lineage for d5vubb_ (5vub B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d5vubb_: 5vub B: [342922]
   automated match to d4n70a_
   complexed with 8gu, gol

Details for d5vubb_

PDB Entry: 5vub, 2 Å

PDB Description: pim1 kinase in complex with a benzofuranone inhibitor

PDB Compounds: (B:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d5vubb_:

Sequence; same for both SEQRES and ATOM records:

>d5vubb_ d.144.1.7 (B:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
sqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkk
vssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleav
rhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiry
hryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrp
sdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d5vubb_:

• d5vubb_ first appeared in SCOPe 2.06
  
• d5vubb_ appears in SCOPe 2.07