SCOPe 2.08: Domain d5xmma1: 5xmm A:2-182

Lineage for d5xmma1 (5xmm A:2-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Cat (Felis catus) [TaxId:9685] [342902] (2 PDB entries)

8. Domain d5xmma1: 5xmm A:2-182 [342917]
   Other proteins in same PDB: d5xmma2, d5xmmb_
   automated match to d3kpma1

Details for d5xmma1

PDB Entry: 5xmm, 2.9 Å

PDB Description: fla-e*01801-167w/s

PDB Compounds: (A:) MHC class I antigen alpha chain

SCOPe Domain Sequences for d5xmma1:

Sequence; same for both SEQRES and ATOM records:

>d5xmma1 d.19.1.1 (A:2-182) automated matches {Cat (Felis catus) [TaxId: 9685]}
gshslryfytavsrpglgeprfiavgyvddtqfvrfdsdapnprmeprapwveqegpeyw
dretrkvkntaqifrvdlntllryynqsesgshniqrmygcdvepdgrllrgynqdsydg
kdyialnedlrswtaadtaaqitgrkweeageaerwrnylqgtcveslakyldmgketll
r

Timeline for d5xmma1:

• d5xmma1 first appeared in SCOPe 2.06
  
• d5xmma1 appears in SCOPe 2.07