SCOPe 2.08: Domain d5xmfb_: 5xmf B:

Lineage for d5xmfb_ (5xmf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Cat (Felis catus) [TaxId:9685] [342900] (2 PDB entries)

8. Domain d5xmfb_: 5xmf B: [342913]
   Other proteins in same PDB: d5xmfa1, d5xmfa2
   automated match to d1duzb_

Details for d5xmfb_

PDB Entry: 5xmf, 2.1 Å

PDB Description: crystal structure of feline mhc class i for 2,1 angstrom

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d5xmfb_:

Sequence; same for both SEQRES and ATOM records:

>d5xmfb_ b.1.1.2 (B:) beta2-microglobulin {Cat (Felis catus) [TaxId: 9685]}
mvqhspkvqvysrhpaengkpnflncyvsgfhppqiditlmkngkkmeaeqtdlsfnrdw
tfyllvhteftptvedeyscqvnhttlsepkvvkwdrdm

Timeline for d5xmfb_:

• d5xmfb_ first appeared in SCOPe 2.06
  
• d5xmfb_ appears in SCOPe 2.07