Lineage for d5mp2c1 (5mp2 C:2-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744148Domain d5mp2c1: 5mp2 C:2-123 [342907]
    Other proteins in same PDB: d5mp2c2, d5mp2d2
    automated match to d1mvfa_

Details for d5mp2c1

PDB Entry: 5mp2 (more details), 2.9 Å

PDB Description: xcpqn012 in complex with vhh04
PDB Compounds: (C:) Camelid nanobody VHH04

SCOPe Domain Sequences for d5mp2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mp2c1 b.1.1.1 (C:2-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesgggsvqaggslrlscaasgntdssyymgwfrqgpgkeregvasiyiragipyyt
dsvkgrftisqdnakntiylqmnslkpedtamyfcagsvrttiqpfkgnyynywgrgtqv
tv

SCOPe Domain Coordinates for d5mp2c1:

Click to download the PDB-style file with coordinates for d5mp2c1.
(The format of our PDB-style files is described here.)

Timeline for d5mp2c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mp2c2