SCOPe 2.08: Domain d5xmfa2: 5xmf A:183-276

Lineage for d5xmfa2 (5xmf A:183-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Cat (Felis catus) [TaxId:9685] [342904] (2 PDB entries)

8. Domain d5xmfa2: 5xmf A:183-276 [342905]
   Other proteins in same PDB: d5xmfa1, d5xmfb_
   automated match to d1efxa1

Details for d5xmfa2

PDB Entry: 5xmf, 2.1 Å

PDB Description: crystal structure of feline mhc class i for 2,1 angstrom

PDB Compounds: (A:) MHC class I antigen alpha chain

SCOPe Domain Sequences for d5xmfa2:

Sequence; same for both SEQRES and ATOM records:

>d5xmfa2 b.1.1.2 (A:183-276) automated matches {Cat (Felis catus) [TaxId: 9685]}
aespntrvtrhpisdrevtlrcwalgfypaeitltwqrdgqdhtqdaelvetrpagdgtf
qkwaavvvssgeeqrytchvqheglrepitlrwe

Timeline for d5xmfa2:

• d5xmfa2 first appeared in SCOPe 2.06
  
• d5xmfa2 appears in SCOPe 2.07