SCOPe 2.06: Domain d5xmfa1: 5xmf A:2-182

Lineage for d5xmfa1 (5xmf A:2-182)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Felis catus [TaxId:9685] [342902] (2 PDB entries)

8. Domain d5xmfa1: 5xmf A:2-182 [342903]
   Other proteins in same PDB: d5xmfa2, d5xmfb_
   automated match to d1efxa2

Details for d5xmfa1

PDB Entry: 5xmf, 2.1 Å

PDB Description: crystal structure of feline mhc class i for 2,1 angstrom

PDB Compounds: (A:) MHC class I antigen alpha chain

SCOPe Domain Sequences for d5xmfa1:

Sequence; same for both SEQRES and ATOM records:

>d5xmfa1 d.19.1.1 (A:2-182) automated matches {Felis catus [TaxId: 9685]}
gshslryfytavsrpglgeprfiavgyvddtqfvrfdsdapnprmeprapwveqegpeyw
dretrkvkntaqifrvdlntllryynqsesgshniqrmygcdvepdgrllrgynqdsydg
kdyialnedlrswtaadtaaqitgrkweeageaerwrnylqgtcvewlakyldmgketll
r

Timeline for d5xmfa1:

• d5xmfa1 is new in SCOPe 2.06-stable
  
• d5xmfa1 appears in SCOPe 2.07
  
• d5xmfa1 appears in the current release, SCOPe 2.08