SCOPe 2.08: Domain d5ucoa1: 5uco A:18-239

Lineage for d5ucoa1 (5uco A:18-239)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Hypericum androsaemum [TaxId:140968] [342879] (1 PDB entry)

8. Domain d5ucoa1: 5uco A:18-239 [342894]
   automated match to d3wd7a1

Details for d5ucoa1

PDB Entry: 5uco, 2.85 Å

PDB Description: benzophenone synthase from hypericum androsaemum

PDB Compounds: (A:) 2,4,6-trihydroxybenzophenone synthase

SCOPe Domain Sequences for d5ucoa1:

Sequence; same for both SEQRES and ATOM records:

>d5ucoa1 c.95.1.0 (A:18-239) automated matches {Hypericum androsaemum [TaxId: 140968]}
krasvlaigttnpehfilqedypdfyfrntnsehmtelkekfkricvkshirkrhfylte
eilkenqgiatygagsldarqriletevpklgqeaalkaiaewgqpiskithvvfattsg
fmmpgadyvitrllglnrtvrrvmlynqgcfaggtalrvakdlaennegarvlvvcaent
amtfhapneshldvivgqamfsdgaaaliigacpdvasgera

Timeline for d5ucoa1:

• d5ucoa1 first appeared in SCOPe 2.06
  
• d5ucoa1 appears in SCOPe 2.07