Lineage for d6bo7f1 (6bo7 F:2-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891731Protein automated matches [190074] (15 species)
    not a true protein
  7. 2891774Species Plasmodium vivax [TaxId:5855] [328484] (1 PDB entry)
  8. 2891780Domain d6bo7f1: 6bo7 F:2-228 [342889]
    Other proteins in same PDB: d6bo7a2, d6bo7b2, d6bo7c2, d6bo7f2
    automated match to d1cjba_
    complexed with mg, ypg

Details for d6bo7f1

PDB Entry: 6bo7 (more details), 2.86 Å

PDB Description: crystal structure of plasmodium vivax hypoxanthine guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3- ((s)-2-hydroxy-2-phosphonoethyl)oxy-1-n-(phosphonopropionyl) pyrrolidine
PDB Compounds: (F:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d6bo7f1:

Sequence, based on SEQRES records: (download)

>d6bo7f1 c.61.1.1 (F:2-228) automated matches {Plasmodium vivax [TaxId: 5855]}
kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi
kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvksycndqs
ldrieivsedlsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplw
ngfkadfvgfsipdafvvgysldynekfrdldhlclvndegikkfrt

Sequence, based on observed residues (ATOM records): (download)

>d6bo7f1 c.61.1.1 (F:2-228) automated matches {Plasmodium vivax [TaxId: 5855]}
kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi
kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvksieivse
dlsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplwngfkadfvg
fsipdafvvgysldynekfrdldhlclvndegikkfrt

SCOPe Domain Coordinates for d6bo7f1:

Click to download the PDB-style file with coordinates for d6bo7f1.
(The format of our PDB-style files is described here.)

Timeline for d6bo7f1: