SCOPe 2.08: Domain d5x3ya1: 5x3y A:109-200

Lineage for d5x3ya1 (5x3y A:109-200)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226227] (6 PDB entries)

8. Domain d5x3ya1: 5x3y A:109-200 [342885]
   Other proteins in same PDB: d5x3ya2
   automated match to d2erra1

Details for d5x3ya1

PDB Entry: 5x3y

PDB Description: refined solution structure of musashi1 rbd2

PDB Compounds: (A:) RNA-binding protein Musashi homolog 1

SCOPe Domain Sequences for d5x3ya1:

Sequence; same for both SEQRES and ATOM records:

>d5x3ya1 d.58.7.0 (A:109-200) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvce
ihfheinnkmveckkaqpkevmsptgsargrs

Timeline for d5x3ya1:

• d5x3ya1 first appeared in SCOPe 2.06
  
• d5x3ya1 appears in SCOPe 2.07